Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo abelii Uncharacterized protein C4orf34 homolog

Recombinant Pongo abelii Uncharacterized protein C4orf34 homolog

SKU:CSB-CF719299PYX

Regular price ¥222,800 JPY
Regular price Sale price ¥222,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5RF07

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAW MVIALILFLLRPPNLRGSNLPGKPTSPHNGQDPPAPPVD

Protein Names:Recommended name: Uncharacterized protein C4orf34 homolog

Gene Names:

Expression Region:1-99

Sequence Info:full length protein

View full details