Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo abelii Motile sperm domain-containing protein 1(MOSPD1)

Recombinant Pongo abelii Motile sperm domain-containing protein 1(MOSPD1)

SKU:CSB-CF722417PYX

Regular price ¥279,400 JPY
Regular price Sale price ¥279,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5RCC7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKY VVVNAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPS AKEQQKEEEEKRIKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGD VESLVPLYLHLSVNQKLVAAYILGLITMAILRT

Protein Names:Recommended name: Motile sperm domain-containing protein 1

Gene Names:Name:MOSPD1

Expression Region:1-213

Sequence Info:full length protein

View full details