
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5NVC3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQLPQHRSKRGSSVGGVCY LSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKI YLDENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFW ELLMNVKRGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCNGKDTYRLRRRATRRRIN KRGAKNCNAIRHFENTFVVETLICGVV
Protein Names:Recommended name: Integral membrane protein 2C Cleaved into the following chain: 1. CT-BRI3
Gene Names:Name:ITM2C
Expression Region:1-267
Sequence Info:full length protein
You may also like
-
Recombinant Bovine Integral membrane protein 2C(ITM2C)
- Regular price
- ¥186,500 JPY
- Sale price
- ¥186,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Integral membrane protein 2C(Itm2c)
- Regular price
- ¥186,200 JPY
- Sale price
- ¥186,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Integral membrane protein 2C(Itm2c)
- Regular price
- ¥186,200 JPY
- Sale price
- ¥186,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Integral membrane protein 2A(ITM2A)
- Regular price
- ¥185,500 JPY
- Sale price
- ¥185,500 JPY
- Regular price
-
- Unit price
- per
Sold out