Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo abelii CKLF-like MARVEL transmembrane domain-containing protein 6(CMTM6)

Recombinant Pongo abelii CKLF-like MARVEL transmembrane domain-containing protein 6(CMTM6)

SKU:CSB-CF729107PYX

Regular price ¥273,300 JPY
Regular price Sale price ¥273,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5RFC1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENGAVYSPTTEEDPGPARGPRSGLAAYCFLGRLPLLRRVLKGLQLSLSLLAFICEEVVS QCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLA SIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFVTMLYEKRQESQLRKSENTTRAEALTEP LNA

Protein Names:Recommended name: CKLF-like MARVEL transmembrane domain-containing protein 6 Alternative name(s): Chemokine-like factor superfamily member 6

Gene Names:Name:CMTM6 Synonyms:CKLFSF6

Expression Region:1-183

Sequence Info:full length protein

View full details