
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5R957
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVSTVDLKR KPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDI FAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDG DEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVE IAYSDVAKRLTK
Protein Names:Recommended name: Chloride intracellular channel protein 4
Gene Names:Name:CLIC4
Expression Region:2-253
Sequence Info:full length protein
You may also like
-
Recombinant Mouse Chloride intracellular channel protein 4(Clic4)
- Regular price
- ¥184,900 JPY
- Sale price
- ¥184,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine Chloride intracellular channel protein 4(CLIC4)
- Regular price
- ¥184,900 JPY
- Sale price
- ¥184,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Chloride intracellular channel exc-4(exc-4)
- Regular price
- ¥189,600 JPY
- Sale price
- ¥189,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pongo abelii Receptor expression-enhancing protein 4(REEP4)
- Regular price
- ¥185,500 JPY
- Sale price
- ¥185,500 JPY
- Regular price
-
- Unit price
- per
Sold out