Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo abelii ADP-ribosylation factor-like protein 6-interacting protein 1(ARL6IP1)

Recombinant Pongo abelii ADP-ribosylation factor-like protein 6-interacting protein 1(ARL6IP1)

SKU:CSB-CF732588PYX

Regular price ¥277,100 JPY
Regular price Sale price ¥277,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5R454

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEGDNRSSNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIY YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV GWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGII SKYIGMAKREINKLLKQKEKKNE

Protein Names:Recommended name: ADP-ribosylation factor-like protein 6-interacting protein 1 Short name= ARL-6-interacting protein 1 Short name= Aip-1 Alternative name(s): Protein TBX2

Gene Names:Name:ARL6IP1 Synonyms:ARL6IP

Expression Region:1-203

Sequence Info:full length protein

View full details