Skip to product information
1 of 1

Gene Bio Systems

Recombinant Poinsettia latent virus Genome-linked protein precursor(ORF2)

Recombinant Poinsettia latent virus Genome-linked protein precursor(ORF2)

SKU:CSB-CF705860PEAR

Regular price ¥284,900 JPY
Regular price Sale price ¥284,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Poinsettia latent virus (isolate Euphorbia pulcherrima/Germany/Siepen/2005) (PnLV) (Poinsettia cryptic virus)

Uniprot NO.:Q5NDN0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TTNVRGNLYNDEGFRLSVGEDDKAEHWTDRLMKSITFKTKRWADWAEEESESDDERGKVV PPAKPSNYGEGCPPEHNQYLSDVGDLLTKVIGPEQNEKCVDILMGIMGVDKNEVAPHKEE KAEKGNEAVVSATVKTVKEPTTQCDEDIISEIVKRVVDKMNLKAIEKSVVEILAEKAMTK APRGKRKNSKDTSRPSTPGSYIIPAKRTPDSGPVEKSLNSTGRAKEESPSGARTLPGNIP AWVR

Protein Names:Recommended name: Genome-linked protein precursor Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg

Gene Names:ORF Names:ORF2

Expression Region:417-660

Sequence Info:full length protein

View full details