Gene Bio Systems
Recombinant Podospora anserina Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
Recombinant Podospora anserina Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
SKU:CSB-CF769829EXJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Uniprot NO.:Q875C2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNGPLSNRPLPSSFDSNDDFYNENGFQKVLRRLKEEPLVPIGCLLTVAAFTNAYRAMRR GDHAKVQKMFRARVAAQAFTVVAMVAGGMYYQADRHKQKELWKLRQQKDAEEKHQKWIRE LEARDAEEKALQERLDKRRKRAAERAGGTGTESVAAQARAALRESKAGKTETGEATSTEA NQADGGVLGSLGGWFGGSKKAPEDTTPALESKPEDPKN
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:AIM31 ORF Names:Pa_5_5310
Expression Region:1-218
Sequence Info:full length protein
