Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pneumococcus phage Dp-1 Holin(dph)

Recombinant Pneumococcus phage Dp-1 Holin(dph)

SKU:CSB-CF516877EXF

Regular price ¥252,100 JPY
Regular price Sale price ¥252,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pneumococcus phage Dp-1 (Bacteriophage Dp-1)

Uniprot NO.:O03978

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLSNEQYDVAKNVVTVVVPAAIALITGLGALYQFDTTAITGTIALLATFAGTVLGVSSR NYQKEQEAQNNEVE

Protein Names:Recommended name: Holin

Gene Names:Name:dph

Expression Region:1-74

Sequence Info:full length protein

View full details