Skip to product information
1 of 1

GeneBio Systems

Recombinant Plasmodium falciparum Circumsporozoite protein, partial

Recombinant Plasmodium falciparum Circumsporozoite protein, partial

SKU:P02893

Regular price ¥153,200 JPY
Regular price Sale price ¥153,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P02893

Gene Names: N/A

Alternative Name(s): (CS)(PfCSP)

Abbreviation: Recombinant Plasmodium falciparum Circumsporozoite protein, partial

Organism: Plasmodium falciparum

Source: E.coli

Expression Region: 336-412aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: KKIKNSISTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYENDIEKKICKMEKCSSVFNVVNSSIGLIMVLSFLFLN

MW: 16.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Essential sporozoite protein. In the mosquito vector, required for sporozoite development in the oocyst, migration through the vector hemolymph and entry into the vector salivary glands. In the vertebrate host, required for sporozoite migration through the host dermis and infection of host hepatocytes. Binds to highly sulfated heparan sulfate proteoglycans (HSPGs) on the surface of host hepatocytes.; [Circumsporozoite protein C-terminus]: In the vertebrate host, binds to highly sulfated heparan sulfate proteoglycans (HSPGs) on the surface of host hepatocytes and is required for sporozoite invasion of the host hepatocytes.

Reference: "Natural Parasite Exposure Induces Protective Human Anti-Malarial Antibodies." Triller G., Scally S.W., Costa G., Pissarev M., Kreschel C., Bosch A., Marois E., Sack B.K., Murugan R., Salman A.M., Janse C.J., Khan S.M., Kappe S.H.I., Adegnika A.A., Mordmueller B., Levashina E.A., Julien J.P., Wardemann H. Immunity 47: 1197-1209.e10(2017)

Function:

View full details