Recombinant Pisum sativum NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic(ndhF)

CSB-CF656863EWE

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pisum sativum (Garden pea)

Uniprot NO.:Q32905

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPSIMTGIAL IGIITVVLGATLAIAQKDIKKNLAYSTMSQLGYMMLALGMGSYRAALFHLITHAYSKALL FLGS

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 5 NADH-plastoquinone oxidoreductase subunit 5

Gene Names:Name:ndhF Synonyms:ndh5

Expression Region:1-124

Sequence Info:full length protein