Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pinus taeda Casparian strip membrane protein 1

Recombinant Pinus taeda Casparian strip membrane protein 1

SKU:CSB-CF319836EVY

Regular price ¥274,500 JPY
Regular price Sale price ¥274,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pinus taeda (Loblolly pine)

Uniprot NO.:P0DH80

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKAESGSADAKLPLPPPVGRKRRGLAILDFLLRLLAIGATLSAAIAMGTNNETLKFFTQF FQFNARFYNLSAFIYFVIANATVGLYLLLSLPFSIFDIVRPRAAAFRVLLIFFDTVMVAV CTSGAAAATAIMYVARRGNTKTNWFSICQQFNSFCDQATGALGASFAAVVLLILLVLLSA STLHRQRADF

Protein Names:Recommended name: Casparian strip membrane protein 1

Gene Names:

Expression Region:1-190

Sequence Info:full length protein

View full details