Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pilin(traA)

Recombinant Pilin(traA)

SKU:CSB-CF319362SWW

Regular price ¥244,900 JPY
Regular price Sale price ¥244,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella typhi

Uniprot NO.:P12060

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TDLLAGGKDDVKATFGADSFVMMCIIIAELIVGVAMYIRTKNLLILLGLVVVIVFTTVGL TFIK

Protein Names:Recommended name: Pilin

Gene Names:Name:traA

Expression Region:56-119

Sequence Info:full length protein

View full details