Gene Bio Systems
Recombinant Pilin(traA)
Recombinant Pilin(traA)
SKU:CSB-CF319362SWW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella typhi
Uniprot NO.:P12060
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TDLLAGGKDDVKATFGADSFVMMCIIIAELIVGVAMYIRTKNLLILLGLVVVIVFTTVGL TFIK
Protein Names:Recommended name: Pilin
Gene Names:Name:traA
Expression Region:56-119
Sequence Info:full length protein
