Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Rhodopsin(RHO),partial

Recombinant Pig Rhodopsin(RHO),partial

SKU:CSB-MP019681PI1

Regular price ¥444,700 JPY
Regular price Sale price ¥444,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:O18766

Gene Names:RHO

Organism:Sus scrofa (Pig)

AA Sequence:MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ

Expression Region:1-36aa

Sequence Info:Partial

Source:Mammalian cell

Tag Info:N-terminal GST-tagged and C-terminal 6xHis-tagged

MW:34.2 kDa

Alternative Name(s):RHO1

Relevance:Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling

Reference:"Structural and functional protein network analyses predict novel signaling functions for rhodopsin." Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Mol. Syst. Biol. 7:551-551(2011)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth

Involvement in disease:

Subcellular Location:Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment

Protein Families:G-protein coupled receptor 1 family, Opsin subfamily

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Ssc&CID=16150

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?ssc:397437

STRING Database Link:https://string-db.org/network/9823.ENSSSCP00000012353

OMIM Database Link:

Lead Time Guidance:18-28 business days

View full details