Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Opalin(OPALIN)

Recombinant Pig Opalin(OPALIN)

SKU:CSB-CF645836PI

Regular price ¥265,000 JPY
Regular price Sale price ¥265,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:Q29102

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFSLNFTLPANTTSSPVVTSGKGADCGPSLGLAAGIPSLVATALLVALLLILIHRRRRS SESTEEIERPCEISEIYDNPRVAENPRRSPTHEKNIMGAEEAHIYVKTVSGSQEPMRDTY RPAVEMERRRGLWWLIPRLSLE

Protein Names:Recommended name: Opalin Alternative name(s): Oligodendrocytic myelin paranodal and inner loop protein Transmembrane protein 10 Transmembrane protein sp83.5

Gene Names:Name:OPALIN Synonyms:SP83.5, TMEM10

Expression Region:1-142

Sequence Info:full length protein

View full details