Skip to product information
1 of 1

Gene Bio Systems

Recombinant Picea sitchensis CASP-like protein 3

Recombinant Picea sitchensis CASP-like protein 3

SKU:CSB-CF518664EVO

Regular price ¥272,500 JPY
Regular price Sale price ¥272,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Picea sitchensis (Sitka spruce) (Pinus sitchensis)

Uniprot NO.:D5A972

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELIYGSTMRKKWIEPALRFLPVGLCISALALMLKSKEGNENGILEYKHVGAFRYLAYAN GICAAYSVLSTFNSVVPRSCSLSRAWFVFVFDQAFTYLMLGAGAVVTEVLYLAYKGDEKI TWFEICPYYGRFCNRVAASLVISFLALLCFIPLSLISAYRVFSKYDPPSLCKKDQITSQS

Protein Names:Recommended name: CASP-like protein 3

Gene Names:

Expression Region:1-180

Sequence Info:full length protein

View full details