Skip to product information
1 of 1

Gene Bio Systems

Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_58644 (PHYPADRAFT_58644)

Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_58644 (PHYPADRAFT_58644)

SKU:CSB-CF435880EVD

Regular price ¥276,500 JPY
Regular price Sale price ¥276,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Physcomitrella patens subsp. patens (Moss)

Uniprot NO.:A9STS7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEPVIVVPRKGVYSDDSYHHHHRHHSFHSCTNFLLRTLTAGATAAAVVVMLISTQTSGT IYGYFRGRWRDYPAYKWLIIANAVVFVYSVMAAIVACFSVIARRGPLSYSPSAWLTLLVD FLAASALISAASAALAVALLARNGQDLQGTHYWPTVCNYVSKFCDYTQGAIIASFVGFGL LFLSTLLAASALYHLSHRRH

Protein Names:Recommended name: CASP-like protein PHYPADRAFT_58644

Gene Names:ORF Names:PHYPADRAFT_58644

Expression Region:1-200

Sequence Info:full length protein

View full details