Skip to product information
1 of 1

Gene Bio Systems

Recombinant Photosystem I reaction center subunit PsaK(psaK)

Recombinant Photosystem I reaction center subunit PsaK(psaK)

SKU:CSB-CF344713EXV

Regular price ¥248,800 JPY
Regular price Sale price ¥248,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Porphyra purpurea

Uniprot NO.:P51370

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDILFVLSAVPHTSPWSTQVAMVMITCNLLAIVAGRYAIKVRGLGPSIPVSGVEGFGLPE LLATTSLGHVIGAASILGLSNVGLIS

Protein Names:Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): PSI-K Photosystem I subunit X

Gene Names:Name:psaK

Expression Region:1-86

Sequence Info:full length protein

View full details