Recombinant Phleum pRatense Pollen allergen Phl p 5b

SKU: CSB-EP671435EUQ

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q40963

Gene Names: N/A

Organism: Phleum pratense (Common timothy)

AA Sequence: ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV

Expression Region: 20-284aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 42.1 kDa

Alternative Name(s): Allergen Phl p Vb Allergen: Phl p 5b

Relevance: Has ribonuclease activity. May be involved in host-pathogen interactions.

Reference: "Major allergen Phl p Vb in timothy grass is a novel pollen RNase."Bufe A., Schramm G., Keown M.B., Schlaak M., Becker W.M.FEBS Lett. 363:6-12(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.