Recombinant Phaeosphaeria nodorum Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)

SKU: CSB-CF607119EUG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Septoria nodorum)

Uniprot NO.:Q0UIR3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AATLPNSIAARYRKQLQKHPFLLFGLPFMATIVAGSFMLTPATALRYERYDRKNQQITQE EAMGLRQERRKVNMKDEYYRLQAKDLEDWEQRRVKRLPGEPDGTLV

Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX16, mitochondrial

Gene Names:Name:COX16 ORF Names:SNOG_08351

Expression Region:11-116

Sequence Info:full length protein