Skip to product information
1 of 1

Gene Bio Systems

Recombinant Phaeosphaeria nodorum Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Phaeosphaeria nodorum Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF609931EUG

Regular price ¥271,400 JPY
Regular price Sale price ¥271,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Septoria nodorum)

Uniprot NO.:Q0V4P1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGMGPPNSAPLPSSFDENADFYNENTIDKIWRRFREEPLIPFGCGLTAWAIVGASRSMR KGDHKMTNLYFRRRLYAQSFTIAVLVIGNLYWQKDRVKRKDYERMKAETERKEKRDRWLR ELEMRDEEDKAWKERLAKKTRGAADEAKGVTDMVAEKTKELKDQTLGK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:SNOG_01023

Expression Region:1-168

Sequence Info:full length protein

View full details