Skip to product information
1 of 1

Gene Bio Systems

Recombinant Petunia sp. Chlorophyll a-b binding protein 13, chloroplastic(CAB13)

Recombinant Petunia sp. Chlorophyll a-b binding protein 13, chloroplastic(CAB13)

SKU:CSB-CF356359PGN

Regular price ¥282,800 JPY
Regular price Sale price ¥282,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Petunia sp. (Petunia)

Uniprot NO.:P04779

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPATFAK NRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFKEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELEVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 13, chloroplastic Alternative name(s): LHCII type I CAB-13 Short name= LHCP

Gene Names:Name:CAB13

Expression Region:35-266

Sequence Info:full length protein

View full details