Gene Bio Systems
Recombinant Pelotomaculum thermopropionicum UPF0059 membrane protein PTH_2827 (PTH_2827)
Recombinant Pelotomaculum thermopropionicum UPF0059 membrane protein PTH_2827 (PTH_2827)
SKU:CSB-CF399166PYG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Uniprot NO.:A5CYC0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFFTLMALAVALGTDALSLSVGIGLTGISRRRILQISATVLLFHIFMPLTGWLVGEFTG SLIGRAAAVIGSLLLVGLGVKMIWAAWRNGGETEPSLVRFNFWGLLLLGASVSMDALSAG FTLGTRQVNLLLAAGVIGLVAGAMTAGGLVFGRFLGSRVGERAQLLGGLILVGIGIKLFF
Protein Names:Recommended name: UPF0059 membrane protein PTH_2827
Gene Names:Ordered Locus Names:PTH_2827
Expression Region:1-180
Sequence Info:full length protein
