Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pelotomaculum thermopropionicum UPF0059 membrane protein PTH_2827 (PTH_2827)

Recombinant Pelotomaculum thermopropionicum UPF0059 membrane protein PTH_2827 (PTH_2827)

SKU:CSB-CF399166PYG

Regular price ¥270,800 JPY
Regular price Sale price ¥270,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)

Uniprot NO.:A5CYC0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFFTLMALAVALGTDALSLSVGIGLTGISRRRILQISATVLLFHIFMPLTGWLVGEFTG SLIGRAAAVIGSLLLVGLGVKMIWAAWRNGGETEPSLVRFNFWGLLLLGASVSMDALSAG FTLGTRQVNLLLAAGVIGLVAGAMTAGGLVFGRFLGSRVGERAQLLGGLILVGIGIKLFF

Protein Names:Recommended name: UPF0059 membrane protein PTH_2827

Gene Names:Ordered Locus Names:PTH_2827

Expression Region:1-180

Sequence Info:full length protein

View full details