Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pelophylax nigromaculatus Tyrosinase(TYR)

Recombinant Pelophylax nigromaculatus Tyrosinase(TYR)

SKU:CSB-CF025394PEM

Regular price ¥329,500 JPY
Regular price Sale price ¥329,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pelophylax nigromaculatus (Black-spotted frog) (Rana nigromaculata)

Uniprot NO.:Q04604

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GIDGHRGGRGTHQSNIRIYSDSAPPWFTKEDISAMRFLSDSRIGHIKQNLLLFESDQTPL

Protein Names:Recommended name: Tyrosinase EC= 1.14.18.1 Alternative name(s): Monophenol monooxygenase

Gene Names:Name:TYR Synonyms:TYRS

Expression Region:20-532

Sequence Info:full length protein

View full details