Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pelobacter carbinolicus ATP synthase subunit a 2(atpB2)

Recombinant Pelobacter carbinolicus ATP synthase subunit a 2(atpB2)

SKU:CSB-CF662655PAAO

Regular price ¥274,100 JPY
Regular price Sale price ¥274,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)

Uniprot NO.:Q3A603

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTHPFVLLKWLIAKLHFGFSAEMLEQHGFFQHVTHTWLVMAILIGVGLLATHRAGLVPGG MQNFMELVLVEIRGMVRDTMGPKGMVYFPLIATLALFLLVSNLIGLIPGFAPPTASLNTN AALAVGVFLVTHIVGVREHGIRYFKHFMGPVWWLTPLILPIELIGHLARPLSLSLRLFGN MYGHEIVLMIFFSLVPLLLPIPMMLMGILVAFIQTFVFMLLSMIYIAGALEEAH

Protein Names:Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2

Gene Names:Name:atpB2 Ordered Locus Names:Pcar_0951

Expression Region:1-234

Sequence Info:full length protein

View full details