Gene Bio Systems
Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0756 membrane protein PC1_1142 (PC1_1142)
Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0756 membrane protein PC1_1142 (PC1_1142)
SKU:CSB-CF512997ESQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Uniprot NO.:C6DBS3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAYLDPTLLILLVLAGLGIISHNMTVTLAILVLLAIRITPLNSYFPWVEKYGLSIGIVIL TIGVMAPIASGKITASEVMHSFLHWKSLLAILIGVAVSWLGGRGVSLMSNQPSVVAGLLV GTVMGVALFRGVPVGPLIAAGLLSLLIGKT
Protein Names:Recommended name: UPF0756 membrane protein PC1_1142
Gene Names:Ordered Locus Names:PC1_1142
Expression Region:1-150
Sequence Info:full length protein
