Gene Bio Systems
Recombinant Pasteurella multocida Uncharacterized protein PM1237(PM1237)
Recombinant Pasteurella multocida Uncharacterized protein PM1237(PM1237)
SKU:CSB-CF866525ESG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pasteurella multocida (strain Pm70)
Uniprot NO.:Q9CLJ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSEQLKIKAMRAAGVGCVLMLMIIALVVFMLPTGILIDYLTLAGSWVGGGTTFGILMLAA LPPLTGAIFYYFWKWVLK
Protein Names:Recommended name: Uncharacterized protein PM1237
Gene Names:Ordered Locus Names:PM1237
Expression Region:1-78
Sequence Info:full length protein
