Gene Bio Systems
Recombinant Pasteurella multocida Uncharacterized protein PM0682(PM0682)
Recombinant Pasteurella multocida Uncharacterized protein PM0682(PM0682)
SKU:CSB-CF861400ESG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pasteurella multocida (strain Pm70)
Uniprot NO.:Q9CMX0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLGYRQAVRHRVLISAFLGSNPSTPAILSNNLHPLHIKIFQLGYRQAVRHRVLISAFLGS NPSTPAITFLNFDFTYFVLRLFYFYFKIFIIFSNLFYRYFPF
Protein Names:Recommended name: Uncharacterized protein PM0682
Gene Names:Ordered Locus Names:PM0682
Expression Region:1-102
Sequence Info:full length protein
