Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pasteurella multocida Uncharacterized protein PM0613(PM0613)

Recombinant Pasteurella multocida Uncharacterized protein PM0613(PM0613)

SKU:CSB-CF863378ESG

Regular price ¥262,600 JPY
Regular price Sale price ¥262,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pasteurella multocida (strain Pm70)

Uniprot NO.:Q9CN32

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQILQKIKNITLTSLELIHVRLDMARIELVEQKNFLITLLSALFVIFILLLVSFISLLFG LNSLLDPETKQIVFFAISAGAFFLILILLLLMRKILKKQRNFMVDTLTEVKHDIQAIKGA LGSPSSKDQE

Protein Names:Recommended name: Uncharacterized protein PM0613

Gene Names:Ordered Locus Names:PM0613

Expression Region:1-130

Sequence Info:full length protein

View full details