Recombinant Pasteurella haemolytica Leukotoxin(lktA),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Pasteurella haemolytica Leukotoxin(lktA),partial

CSB-YP314743ESE
Regular price
¥174,500 JPY
Sale price
¥174,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P0C085

Gene Names: lktA

Organism: Mannheimia haemolytica (Pasteurella haemolytica)

AA Sequence: IGTSHNDIFKGSKFNDAFNGGDGVDTIDGNDGNDRLFGGKGDDIIDGGNGDDFIDGGKGNDLLHGGKGDDIFVHRQGDGNDSITESEGNDKLSFSDSNLKDLTFEKVNHHLVITNTKQEKVTIQNWFREAEFAKTIQNYVATRDDKIEEIIGQNGERITSKQVDELIEKGNGKIAQSELTKVVDNYQLLKYSRDASNSLDKLISSASAFTSSNDSRNVLASPTSMLDPSLSSIQFARAA

Expression Region: 715-953aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 28 kDa

Alternative Name(s):

Relevance: Pasteurella leukotoxins are exotoxins that attack host leukocytes and especially polymorphonuclear cells, by causing cell rupture. The leukotoxin binds to the host LFA-1 integrin and induces a signaling cascade leading to many biological effects, including tyrosine phosphorylation of the CD18 tail, elevation of the intracellular Ca2+ and lysis of the host cell . This leukotoxin is a major contributor to the pathogenesis of lung injury in ovine pneumonic pasteurellosis. It has also weak holytic activity.

Reference: Sequence diversity and molecular evolution of the leukotoxin (lktA) gene in bovine and ovine strains of Mannheimia (Pasteurella) haemolytica.Davies R.L., Whittam T.S., Selander R.K.J. Bacteriol. 183:1394-1404(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Pasteurella haemolytica Leukotoxin(lktA),partial
    Regular price
    ¥159,000 JPY
    Sale price
    ¥159,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mannheimia haemolytica Leukotoxin(lktA),partial
    Regular price
    ¥159,000 JPY
    Sale price
    ¥159,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mannheimia haemolytica Leukotoxin(lktA),partial
    Regular price
    ¥159,000 JPY
    Sale price
    ¥159,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin(ltxA),partial
    Regular price
    ¥174,500 JPY
    Sale price
    ¥174,500 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share