Skip to product information
1 of 1

Gene Bio Systems

Recombinant Paracoccus versutus Methylamine utilization protein mauE(mauE)

Recombinant Paracoccus versutus Methylamine utilization protein mauE(mauE)

SKU:CSB-CF690902PCD

Regular price ¥273,400 JPY
Regular price Sale price ¥273,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Paracoccus versutus (Thiobacillus versutus)

Uniprot NO.:Q56460

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQQVLQEPLIHWALRSFLAALFATAALSKLTGMEEFHGVVRNFRLLPDMASRAVAMVLPV AELAVAAGLMIPALAAPAALAAAALLGVFGLAIAVNVLRGRTQIDCGCFRNGMKQRISWA MVARNAVLTAMALGAAALLPAARPGGTADLATGMLAGSVLFLLYFSASMLGGLPARHPST ASVKGR

Protein Names:Recommended name: Methylamine utilization protein mauE

Gene Names:Name:mauE Synonyms:madE

Expression Region:1-186

Sequence Info:full length protein

View full details