Skip to product information
1 of 1

Gene Bio Systems

Recombinant Papio cynocephalus Platelet glycoprotein Ib beta chain(GP1BB)

Recombinant Papio cynocephalus Platelet glycoprotein Ib beta chain(GP1BB)

SKU:CSB-CF009686PBR

Regular price ¥268,700 JPY
Regular price Sale price ¥268,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Papio cynocephalus (Yellow baboon)

Uniprot NO.:Q04785

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKMPVPPVGSGDCQGQCGVIKRPLDMSEVFAFHLDRVLGLNRTLPSVSRSLEFVQDGQPC

Protein Names:Recommended name: Platelet glycoprotein Ib beta chain Short name= GP-Ib beta Short name= GPIb-beta Short name= GPIbB Alternative name(s): Antigen CD42b-beta CD_antigen= CD42c

Gene Names:Name:GP1BB

Expression Region:27-208

Sequence Info:full length protein

View full details