Gene Bio Systems
Recombinant Paenibacillus sp. UPF0756 membrane protein Pjdr2_2290 (Pjdr2_2290)
Recombinant Paenibacillus sp. UPF0756 membrane protein Pjdr2_2290 (Pjdr2_2290)
SKU:CSB-CF514768EQM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Paenibacillus sp. (strain JDR-2)
Uniprot NO.:C6CU08
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMTGELILVGLIVIGLIGRSPIIATAACVLLAVKLLHLSRFLPSIERRGLELGLLFLTLS VLVPFASGKVQMKELIAAFNTWPGWLALIGGAVAAYMNAKGLDLLKLDPQMVVGLVIGSI FGIIFLRGIPVGPLMAAGITAILYKLFKLMSGG
Protein Names:Recommended name: UPF0756 membrane protein Pjdr2_2290
Gene Names:Ordered Locus Names:Pjdr2_2290
Expression Region:1-153
Sequence Info:full length protein
