Skip to product information
1 of 1

Gene Bio Systems

Recombinant Paenibacillus sp. UPF0756 membrane protein Pjdr2_2290 (Pjdr2_2290)

Recombinant Paenibacillus sp. UPF0756 membrane protein Pjdr2_2290 (Pjdr2_2290)

SKU:CSB-CF514768EQM

Regular price ¥268,500 JPY
Regular price Sale price ¥268,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Paenibacillus sp. (strain JDR-2)

Uniprot NO.:C6CU08

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMTGELILVGLIVIGLIGRSPIIATAACVLLAVKLLHLSRFLPSIERRGLELGLLFLTLS VLVPFASGKVQMKELIAAFNTWPGWLALIGGAVAAYMNAKGLDLLKLDPQMVVGLVIGSI FGIIFLRGIPVGPLMAAGITAILYKLFKLMSGG

Protein Names:Recommended name: UPF0756 membrane protein Pjdr2_2290

Gene Names:Ordered Locus Names:Pjdr2_2290

Expression Region:1-153

Sequence Info:full length protein

View full details