Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF36(ORF36)

Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF36(ORF36)

SKU:CSB-CF757712OBAD

Regular price ¥253,100 JPY
Regular price Sale price ¥253,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ostreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus)

Uniprot NO.:Q6R7I8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTTEQTVCEIEQESELIPAKPQYIIVKKPKRQAWQRVLLLFRIINMIVIWAALIALFVK LYILRGPIPRSYFHY

Protein Names:Recommended name: Uncharacterized protein ORF36

Gene Names:ORF Names:ORF36

Expression Region:1-75

Sequence Info:full length protein

View full details