Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 2(SCAMP2)

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 2(SCAMP2)

SKU:CSB-CF759017OFG

Regular price ¥293,800 JPY
Regular price Sale price ¥293,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q7F613

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGRYDRNPFDEDDVNPFAGGSVPPASNSRMPPLPHEPGFYNDRGATVDIPLDSTKDMKK KEKELQAKEAELNKRESELRRREEAASRAGIVIEEKNWPPFFPIIHHDISNEIPIHLQRM QYLAFSSLLGLAACLFWNIIATTAAWIKGAGVMIWLLAIIYFISGVPGAYVLWYRPLYNA MRTESALKFGWFFLFYLIHILFCIWSAVAPPFPFKGKSLAGILPAIDVIGNNAIVGIFYF IGFGLFCLESLLSVVVIQQVYMYFRGSGKAAEMKREAARGAMRSAF

Protein Names:Recommended name: Secretory carrier-associated membrane protein 2 Short name= RiSC Short name= Secretory carrier membrane protein 2

Gene Names:Name:SCAMP2 Synonyms:SC Ordered Locus Names:Os01g0780500, LOC_Os01g57220 ORF Names:P0010B10.29

Expression Region:1-286

Sequence Info:full length protein

View full details