Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Putative bidirectional sugar transporter SWEET7d(SWEET7D)

Recombinant Oryza sativa subsp. japonica Putative bidirectional sugar transporter SWEET7d(SWEET7D)

SKU:CSB-CF498349OFG

Regular price ¥280,300 JPY
Regular price Sale price ¥280,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:B9G2E6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHLLLLSRRPPWPGEARRCLAAGARAGDGREGFLLNFFTRWLHGGAERPLRPRLEEVGER GREVAGELPARTKQTGRRSTSAATSRRDGVPDLIRNVVGIVGNVISFGLFLSPVPTFWRI IKNKDVRDFKADQYLATLLNCMVFYGLPIVHPNSILVVTINGIGLVIEAVYLTIFFLFSD KKNKKKMGVVLATEALFMAAVALGVLLDAHTHQRRSSAP

Protein Names:Recommended name: Putative bidirectional sugar transporter SWEET7d Short name= OsSWEET7d

Gene Names:Name:SWEET7D Ordered Locus Names:Os09g0259200, LOC_Os09g08490 ORF Names:OsJ_28570

Expression Region:1-219

Sequence Info:full length protein

View full details