Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP2-2(TIP2-2)

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP2-2(TIP2-2)

SKU:CSB-CF733508OFG

Regular price ¥276,200 JPY
Regular price Sale price ¥276,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q5Z6F0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGNIAFGRFDDSFSAASLKAYVAEFISTLVFVFAGVGSAIAYTKLTGGAPLDPAGLVAV AVCHGFGLFVAVAIGANISGGHVNPAVTFGLALGGQITILTGVFYWIAQLLGAIVGAVLV QFCTGVATPTHGLSGVGAFEGVVMEIIVTFGLVYTVYATAADPKKGSLGTIAPIAIGFIV GANILVAGPFSGGSMNPARSFGPAVASGDYTNIWIYWVGPLVGGGLAGLVYRYVYMCGDH APVASSEF

Protein Names:Recommended name: Probable aquaporin TIP2-2 Alternative name(s): Tonoplast intrinsic protein 2-2 Short name= OsTIP2;2

Gene Names:Name:TIP2-2 Ordered Locus Names:Os06g0336200, LOC_Os06g22960 ORF Names:OsJ_020360, OSJNBa0012F14.45-1, P0427E01.5-1

Expression Region:1-248

Sequence Info:full length protein

View full details