Recombinant Oryza sativa subsp. japonica Photosystem I reaction center subunit VI, chloroplastic(PSAH)

SKU: CSB-CF612305OFG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q0DG05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KYGEKSVYFDLEDIGNTTGQWDLYGSDAPSPYNPLQSKFFETFAGPFTKRGLLLKFLLLG GGSLVAYVSASASPDLLPIKKGPQLPPTPGPRGKI

Protein Names:Recommended name: Photosystem I reaction center subunit VI, chloroplastic Short name= PSI-H Alternative name(s): Light-harvesting complex I 11 kDa protein Protein GOS5

Gene Names:Name:PSAH Synonyms:GOS5 Ordered Locus Names:Os05g0560000, LOC_Os05g48630 ORF Names:OJ1115_B06.3, OsJ_018737, OSJNBa0001A14.18

Expression Region:48-142

Sequence Info:full length protein