Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Defender against cell death 1(DAD1)
Recombinant Oryza sativa subsp. japonica Defender against cell death 1(DAD1)
SKU:CSB-CF006487OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q0JDK9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLS GVLSCIGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG
Protein Names:Recommended name: Defender against cell death 1 Short name= DAD-1 Alternative name(s): Defender against apoptotic death 1 protein
Gene Names:Name:DAD1 Synonyms:DAD-1 Ordered Locus Names:Os04g0397000, LOC_Os04g32550 ORF Names:OsJ_014065, OSJNBa0039C07.3
Expression Region:1-114
Sequence Info:full length protein
