Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Cytochrome c oxidase subunit 5C(COX5C)
Recombinant Oryza sativa subsp. japonica Cytochrome c oxidase subunit 5C(COX5C)
SKU:CSB-CF879877OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q9SXX7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AGGRIAHATLKGPSVVKEICIGLTLGLVAGGLWKMHHWNEQRKTRSFYDMLEKGQISVVV EE
Protein Names:Recommended name: Cytochrome c oxidase subunit 5C Alternative name(s): Cytochrome c oxidase polypeptide Vc
Gene Names:Name:COX5C Ordered Locus Names:Os12g0561000, LOC_Os12g37419
Expression Region:2-63
Sequence Info:full length protein
