Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica CASP-like protein Os12g0610800(Os12g0610800, LOC_Os12g41690)

Recombinant Oryza sativa subsp. japonica CASP-like protein Os12g0610800(Os12g0610800, LOC_Os12g41690)

SKU:CSB-CF609416OFG

Regular price ¥276,500 JPY
Regular price Sale price ¥276,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q0ILZ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLEKGKKPSEQAAACRIMQVKDKLITLQPVVRACVFLATAVAAVIMGLNKQSYTTVVAI VGTRPVTQTFTAKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQRRAQSLSVHLLDMVI LTLLATGSATAASMAQLGKNGNLHARWNPICDKFGSFCNHGGIALVSSFIGVALMLALNL LSAAANSPRSNVTGQ

Protein Names:Recommended name: CASP-like protein Os12g0610800

Gene Names:Ordered Locus Names:Os12g0610800, LOC_Os12g41690 ORF Names:OsJ_035393, OsJ_36834

Expression Region:1-195

Sequence Info:full length protein

View full details