Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. indica UPF0603 protein OsI_019212, chloroplastic (OsI_19898)

Recombinant Oryza sativa subsp. indica UPF0603 protein OsI_019212, chloroplastic (OsI_19898)

SKU:CSB-CF386094OFF

Regular price ¥277,600 JPY
Regular price Sale price ¥277,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:A2Y4G9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SEFDVLNGGPPEDTYVVDDAGVLSRVTKSDVKRLVRDLESRKNIRINFITVRKLTSKADA FEYADQVLEKWYPTVEEGNNKGIVVLVTSQKEGAITGGPAFVQAVGDEILDSTVSENLPV LATDEKYNEAIYTTAKRLAAAIDGLPDPGGPTFKDNKRESNFKTKEETEEKRGQFTLVVG GLLVIAFVVPMAQYYAYISKK

Protein Names:Recommended name: UPF0603 protein OsI_019212, chloroplastic

Gene Names:ORF Names:OsI_19898

Expression Region:99-299

Sequence Info:full length protein

View full details