Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. indica Casparian strip membrane protein OsI_22263 (OsI_22263)

Recombinant Oryza sativa subsp. indica Casparian strip membrane protein OsI_22263 (OsI_22263)

SKU:CSB-CF387257OFF

Regular price ¥274,400 JPY
Regular price Sale price ¥274,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:A2YAZ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGSEEHGETSKAPLSRGVSKGVSILDVILRFVAIIGTLASAIAMGTTNQTLPFFTQFIR FKAQYSDLPTLTFFVVANSIVSAYLILSLPLSIVHVIRSRAKYSRLILIFFDAAMLALVT AGASAAAAIVYLAHKGNARANWLAICQQFDSFCERISGSLIGSFAAMVVLVLLIFLSAIA LARR

Protein Names:Recommended name: Casparian strip membrane protein OsI_22263

Gene Names:ORF Names:OsI_22263

Expression Region:1-184

Sequence Info:full length protein

View full details