Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_30044 (OsI_30044)

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_30044 (OsI_30044)

SKU:CSB-CF383748OFF

Regular price ¥271,200 JPY
Regular price Sale price ¥271,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:A2YXI1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVELESQEAVTVASTADIAVDVSLRLLAAATSLASAVVVAANHQQRWGVRVDFTLFQVWI GFVAVNLVCTVYAAATAAAARKAMGRWWLHHADAVVVNLEAAATAGAGAIGSIAMWGNEA SGWYAVCRLYRRYCNAGAAALALSLAAVLLLGVACARSRYPKMPPTT

Protein Names:Recommended name: CASP-like protein OsI_30044

Gene Names:ORF Names:OsI_30044

Expression Region:1-167

Sequence Info:full length protein

View full details