Gene Bio Systems
Recombinant Oryza sativa subsp. indica CASP-like protein OsI_01069 (OsI_01069)
Recombinant Oryza sativa subsp. indica CASP-like protein OsI_01069 (OsI_01069)
SKU:CSB-CF383681OFF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. indica (Rice)
Uniprot NO.:A2WMK1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFSAKARWIVAVVLRVAAAGAAAVAAVLMAMSHDEVIVYGMEVQAKFRYTPSLVFFVAAN AAVSACSLVVLLVPSSTSKLAARLLLMADVVLGMVLAGALAAAGAMAELGKNGNSHAGWI AICVQVPLFCDRVRSALVAGSATIVLYYLMLMYSIYTLPMFP
Protein Names:Recommended name: CASP-like protein OsI_01069
Gene Names:ORF Names:OsI_01069
Expression Region:1-162
Sequence Info:full length protein
