Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. indica CASP-like protein BLE3(BLE3)

Recombinant Oryza sativa subsp. indica CASP-like protein BLE3(BLE3)

SKU:CSB-CF387251OFF

Regular price ¥269,100 JPY
Regular price Sale price ¥269,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:A2Y2B7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKVHRLMNAVLRLAAAAAAATAAVVMVTSRETTSFFGIQMEAKYSYTPSFIFFVVAYAV AAAYSLLVLAVPAGSALSRLALTTDVVLGMVLAGAVASAGAISDIAKNGNSHAGWLPVCG QIHAYCNHVMAALIAGFVALAVHFVVVMYSLHIVTDVICPCH

Protein Names:Recommended name: CASP-like protein BLE3 Alternative name(s): Protein brassinolide-enhanced BLE3 Short name= OsBLE3 Short name= Protein BL-enhanced 3

Gene Names:Name:BLE3 ORF Names:OsI_19146

Expression Region:1-162

Sequence Info:full length protein

View full details