Gene Bio Systems
Recombinant Oligotropha carboxidovorans UPF0060 membrane protein OCAR_5428-OCA5_c25530 (OCAR_5428, OCA5_c25530)
Recombinant Oligotropha carboxidovorans UPF0060 membrane protein OCAR_5428-OCA5_c25530 (OCAR_5428, OCA5_c25530)
SKU:CSB-CF478309OED
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5)
Uniprot NO.:B6JBL9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSLAAFVGAALMEIGGCFAFWAWLRLGQSPLWLIPGMAALALFAYLLTLVDSPLAGRAY AAYGGIYIASALVWGWAMEGHRPDRWDVAGATICLIGMAVILFGPRPAAL
Protein Names:Recommended name: UPF0060 membrane protein OCAR_5428/OCA5_c25530
Gene Names:Ordered Locus Names:OCAR_5428, OCA5_c25530
Expression Region:1-110
Sequence Info:full length protein
