Skip to product information
1 of 1

Gene Bio Systems

Recombinant Odontella sinensis Probable protein-export membrane protein secG(secG)

Recombinant Odontella sinensis Probable protein-export membrane protein secG(secG)

SKU:CSB-CF342625OAK

Regular price ¥219,000 JPY
Regular price Sale price ¥219,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)

Uniprot NO.:P49542

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLFLKLIWLLVSIFLISIIYLRVPRNQGLTSFATKSDLLGSPNSTEKFLNNFTLILIISY YLIAVKLNQMSIIG

Protein Names:Recommended name: Probable protein-export membrane protein secG

Gene Names:Name:secG Synonyms:ycf47

Expression Region:1-74

Sequence Info:full length protein

View full details