Gene Bio Systems
Recombinant Oceanobacillus iheyensis UPF0295 protein OB0906(OB0906)
Recombinant Oceanobacillus iheyensis UPF0295 protein OB0906(OB0906)
SKU:CSB-CF815986OAB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)
Uniprot NO.:Q8CV51
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSQQLTYSSKINKIRTFALILVFAGIITMYGGILTKNIEWLMVIFFILGTLMVILSCAVY VWIGTLSLRAVPVICPSCEKPTKMLGRVDACMHCKQPLTMDKNLEGIEFDEKYNSRKYKK K
Protein Names:Recommended name: UPF0295 protein OB0906
Gene Names:Ordered Locus Names:OB0906
Expression Region:1-121
Sequence Info:full length protein
