Skip to product information
1 of 1

Gene Bio Systems

Recombinant Novosphingobium aromaticivorans UPF0314 protein Saro_1818(Saro_1818)

Recombinant Novosphingobium aromaticivorans UPF0314 protein Saro_1818(Saro_1818)

SKU:CSB-CF640275NFD

Regular price ¥276,600 JPY
Regular price Sale price ¥276,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Novosphingobium aromaticivorans (strain DSM 12444)

Uniprot NO.:Q2G7B5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNRQGVRLLPDRGGSLAAFGVGLAVVIILLGMGRPPICPCGVVRLWHGVVESAENSQQVS DWYSFSHLIHGFLFYGAAHIVWRRFGFAELSPRWALALAVLIEGSWEILENSPIIIDRYR SVTISWGYSGDSVLNSAADIGFMAAGFLFAARAPVLVTVVLGIGFELFTLWAIRDNLALN ILMLVWPVEAVRVWQGGG

Protein Names:Recommended name: UPF0314 protein Saro_1818

Gene Names:Ordered Locus Names:Saro_1818

Expression Region:1-198

Sequence Info:full length protein

View full details